PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G078000.6
Common NameB456_003G078000, LOC105788203
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 624aa    MW: 70085.3 Da    PI: 6.858
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G078000.6genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.31.7e-24104204198
                         EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                         f+kvlt sd++++g +++ +k+a+e+     +++ + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   +
  Gorai.003G078000.6 104 FCKVLTASDTSTHGGFSVLRKHATEClppldMNQATPTQELVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVFL--R 192
                         99****************************9555556679************************************************..4 PP

                         SSEE..EEEEE- CS
                  B3  87 rsefelvvkvfr 98 
                          +++el+v+v+r
  Gorai.003G078000.6 193 GESGELRVGVRR 204
                         49999*****98 PP

2Auxin_resp105.94.6e-35230309183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha+st++ F v+Y+Pr+  s+F++ ++k+++al++k++vGmRfkm+fe+eds+err+sGt+vgv+d++p  W++SkWrsLk
  Gorai.003G078000.6 230 ASHAVSTQTLFVVYYKPRT--SQFIIGLNKYLEALNNKFTVGMRFKMRFEGEDSPERRFSGTIVGVEDFSP-YWKDSKWRSLK 309
                         789***************6..9*************************************************.9********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.14E-4095233IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.3E-4097219IPR015300DNA-binding pseudobarrel domain
CDDcd100171.20E-20103204No hitNo description
SMARTSM010191.8E-23104206IPR003340B3 DNA binding domain
PROSITE profilePS5086312.266104206IPR003340B3 DNA binding domain
PfamPF023621.5E-22104204IPR003340B3 DNA binding domain
PfamPF065071.2E-32230309IPR010525Auxin response factor
PfamPF023091.0E-7521623IPR033389AUX/IAA domain
SuperFamilySSF542772.65E-12549623No hitNo description
PROSITE profilePS5174524.155556623IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MELWKLCAGP LVEAPRARER VYYFPQGHME QLEASTNQEL NQRIPLFNLP SKILCSVVHI  60
QFLAEQETDE VYAQITLMPE PNQPEPTTPD ACPPEPPKPT VCSFCKVLTA SDTSTHGGFS  120
VLRKHATECL PPLDMNQATP TQELVAKDLH GYEWRFKHIF RGQPRRHLLT TGWSTFVTSK  180
RLVAGDSFVF LRGESGELRV GVRRVARQQS SMPTSVISSQ SMHLGVLATA SHAVSTQTLF  240
VVYYKPRTSQ FIIGLNKYLE ALNNKFTVGM RFKMRFEGED SPERRFSGTI VGVEDFSPYW  300
KDSKWRSLKV QWDEPASIPR PDRVSPWEIE PFAAPIPPTL GQPVAAKNKR PRPTAEIPAL  360
ELPSTASAPW NSGVMHTHDL MRRNITAEAN RNENHVIWHM QTEMSSSCSS VLKTQNEGSW  420
LSSPCMSVSK HRFPDARDDS KCASGWPVLS GLSNPQVNND STFDPIEKVK KSETASSCRL  480
FGIELINHSA SSRQLERTPT QLSTMTASTA EGHHTLSPNN SCQKSEISKD SNEKQEQLQL  540
QAKEIQSRQS CPSSTRSRTK VQMQGVAVGR AVDLAMLEGY DQLIDELEEM FDIKGELRPR  600
NKWEIVYTDD EGDMMLVGDD PWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-175233222355Auxin response factor 1
4ldw_A1e-175233222355Auxin response factor 1
4ldw_B1e-175233222355Auxin response factor 1
4ldx_A1e-174233222355Auxin response factor 1
4ldx_B1e-174233222355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1348352KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5850156e-43JX585015.1 Gossypium hirsutum clone NBRI_GE18462 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012470429.10.0PREDICTED: auxin response factor 9 isoform X2
RefseqXP_012470428.10.0PREDICTED: auxin response factor 9 isoform X1
RefseqXP_012470427.10.0PREDICTED: auxin response factor 9 isoform X1
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A0D2MKQ50.0A0A0D2MKQ5_G
TrEMBLA0A0D2NY140.0A0A0D2NY14_G
STRINGVIT_02s0025g01740.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]